missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OLAH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | OLAH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OLAH Polyclonal specifically detects OLAH in Human samples. It is validated for Western Blot.Specifications
| OLAH | |
| Polyclonal | |
| Rabbit | |
| Q9NV23 | |
| 55301 | |
| Synthetic peptides corresponding to OLAH(oleoyl-ACP hydrolase) The peptide sequence was selected from the N terminal of OLAH. Peptide sequence MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.1.2.14, FLJ11106, medium chain, MGC51852, oleoyl-ACP hydrolaseAURA1, SAST, THEDC1, thioesterase domain containing 1, Thioesterase II | |
| OLAH | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title