missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OLAH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56829
This item is not returnable.
View return policy
Description
OLAH Polyclonal specifically detects OLAH in Human samples. It is validated for Western Blot.
Specifications
| OLAH | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.1.2.14, FLJ11106, medium chain, MGC51852, oleoyl-ACP hydrolaseAURA1, SAST, THEDC1, thioesterase domain containing 1, Thioesterase II | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 55301 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9NV23 | |
| OLAH | |
| Synthetic peptides corresponding to OLAH(oleoyl-ACP hydrolase) The peptide sequence was selected from the N terminal of OLAH. Peptide sequence MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Equine: 83%; Mouse: 76%. | |
| Human, Mouse, Pig, Equine, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction