missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OCT6. Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | OCT6. |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
44475 Polyclonal specifically detects 44475 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry-Paraffin.Specifications
| OCT6. | |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers | |
| PBS buffer, 2% sucrose | |
| 5453 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| Oct-6, OCT6POU domain transcription factor SCIP, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF6, OTF-6, POU class 3 homeobox 1, POU domain class 3, transcription factor 1, POU domain, class 3, transcription factor 1, SCIP | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Rat OCT6 (NP_620193). Peptide sequence CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title