missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OATP1B3/SLCO1B3/OATP8 Antibody (CL3771), Novus Biologicals™
Mouse Monoclonal Antibody
£222.00 - £443.00
Specifications
| Antigen | OATP1B3/SLCO1B3/OATP8 |
|---|---|
| Clone | CL3771 |
| Dilution | Immunohistochemistry 1:500 - 1:10000 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18256951
|
Novus Biologicals
NBP2-61637 |
100 μL |
£443.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607207
|
Novus Biologicals
NBP2-61637-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OATP1B3/SLCO1B3/OATP8 Monoclonal specifically detects OATP1B3/SLCO1B3/OATP8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| OATP1B3/SLCO1B3/OATP8 | |
| Immunohistochemistry 1:500 - 1:10000 | |
| Unconjugated | |
| Mouse | |
| Human | |
| 28234 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL3771 | |
| Monoclonal | |
| Purified | |
| Cancer | |
| Liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, LST2, LST-2, LST3, OATP1B3LST-3TM13, OATP8, OATP-8, Organic anion transporter 8, organic anion transporter LST-3c, Organic anion-transporting polypeptide 8, SLC21A8, solute carrier family 21 (organic anion transporter), member 8, Solute carrier family 21 member 8, solute carrier organic anion transporter family member 1B3, solute carrier organic anion transporter family, member 1B3 | |
| SLCO1B3 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title