OATP1B3/SLCO1B3/OATP8 Antibody (CL3771), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-61637-25ul

Product Code. 18607207

Description

OATP1B3/SLCO1B3/OATP8 Monoclonal specifically detects OATP1B3/SLCO1B3/OATP8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OATP1B3/SLCO1B3/OATP8
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SLCO1B3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 28234
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL3771
• Dilution: Immunohistochemistry 1:500 - 1:10000
• Gene Alias: Liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, LST2, LST-2, LST3, OATP1B3LST-3TM13, OATP8, OATP-8, Organic anion transporter 8, organic anion transporter LST-3c, Organic anion-transporting polypeptide 8, SLC21A8, solute carrier family 21 (organic anion transporter), member 8, Solute carrier family 21 member 8, solute carrier organic anion transporter family member 1B3, solute carrier organic anion transporter family, member 1B3
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG1