missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OATL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | OATL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OATL1 Polyclonal specifically detects OATL1 in Human samples. It is validated for Western Blot.Specifications
| OATL1 | |
| Polyclonal | |
| Rabbit | |
| Q3MII6 | |
| 4943 | |
| Synthetic peptides corresponding to TBC1D25(TBC1 domain family, member 25) The peptide sequence was selected from the N terminal of TBC1D25. Peptide sequence KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MG81, MGC126866, MGC126868, MGC149732, OATL1MGC149731, ornithine aminotransferase-like 1, TBC1 domain family member 25, TBC1 domain family, member 25 | |
| TBC1D25 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title