missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OATL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56840
This item is not returnable.
View return policy
Description
OATL1 Polyclonal specifically detects OATL1 in Human samples. It is validated for Western Blot.
Specifications
| OATL1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| MG81, MGC126866, MGC126868, MGC149732, OATL1MGC149731, ornithine aminotransferase-like 1, TBC1 domain family member 25, TBC1 domain family, member 25 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4943 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q3MII6 | |
| TBC1D25 | |
| Synthetic peptides corresponding to TBC1D25(TBC1 domain family, member 25) The peptide sequence was selected from the N terminal of TBC1D25. Peptide sequence KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 84%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction