missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUFIP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | NUFIP2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18231362
|
Novus Biologicals
NBP2-55795 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693527
|
Novus Biologicals
NBP2-55795-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NUFIP2 Polyclonal specifically detects NUFIP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NUFIP2 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 57532 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 182-FIP, Cell proliferation-inducing gene 1 protein, FIP-82, FLJ10976, FMRP-interacting protein 2, Fragile X Mental Retardation Protein, KIAA1321PIG1,82-FIP82-kD FMRP Interacting Protein, MGC117262, nuclear fragile X mental retardation protein interacting protein 2, nuclear fragile X mental retardation-interacting protein 2, proliferation-inducing gene 1,82 kDa FMRP-interacting protein | |
| NUFIP2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title