missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUFIP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55795
This item is not returnable.
View return policy
Description
NUFIP2 Polyclonal specifically detects NUFIP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| NUFIP2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| 182-FIP, Cell proliferation-inducing gene 1 protein, FIP-82, FLJ10976, FMRP-interacting protein 2, Fragile X Mental Retardation Protein, KIAA1321PIG1,82-FIP82-kD FMRP Interacting Protein, MGC117262, nuclear fragile X mental retardation protein interacting protein 2, nuclear fragile X mental retardation-interacting protein 2, proliferation-inducing gene 1,82 kDa FMRP-interacting protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NUFIP2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG | |
| 100 μL | |
| Neuroscience | |
| 57532 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction