missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUDT13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NUDT13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NUDT13 Polyclonal specifically detects NUDT13 in Human samples. It is validated for Western Blot.Specifications
| NUDT13 | |
| Polyclonal | |
| Rabbit | |
| Q86X67 | |
| 25961 | |
| Synthetic peptides corresponding to NUDT13(nudix (nucleoside diphosphate linked moiety X)-type motif 13) The peptide sequence was selected from the N terminal of NUDT13. Peptide sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp586P2219, EC 3.-, nucleoside diphosphate-linked moiety X motif 13, nudix (nucleoside diphosphate linked moiety X)-type motif 13, Nudix motif 13, Protein KiSS-16 | |
| NUDT13 | |
| IgG | |
| 40 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title