missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NSUN5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89416
This item is not returnable.
View return policy
Description
NSUN5 Polyclonal specifically detects NSUN5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| NSUN5 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| EC 2.1.1.-, FLJ10267, member 5A, MGC986, NOL1, NOL1/NOP2/Sun domain family member 5, NOL1/NOP2/Sun domain family, member 5, NOL1R(NOL1), NOL1-related protein, NOP2/Sun domain family, member 5, NSUN5A, p120, putative methyltransferase NSUN5, WBSCR20, WBSCR20A, Williams-Beuren syndrome chromosomal region 20A protein, Williams-Beuren syndrome critical region protein 20 copy A, Ynl022cL | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 55695 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NSUN5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction