missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NSUN5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | NSUN5 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18414261
|
Novus Biologicals
NBP1-89416-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18296126
|
Novus Biologicals
NBP1-89416 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NSUN5 Polyclonal specifically detects NSUN5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| NSUN5 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55695 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 2.1.1.-, FLJ10267, member 5A, MGC986, NOL1, NOL1/NOP2/Sun domain family member 5, NOL1/NOP2/Sun domain family, member 5, NOL1R(NOL1), NOL1-related protein, NOP2/Sun domain family, member 5, NSUN5A, p120, putative methyltransferase NSUN5, WBSCR20, WBSCR20A, Williams-Beuren syndrome chromosomal region 20A protein, Williams-Beuren syndrome critical region protein 20 copy A, Ynl022cL | |
| NSUN5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title