missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NSDHL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | NSDHL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
NSDHL Polyclonal specifically detects NSDHL in Human samples. It is validated for Western Blot.Specifications
| NSDHL | |
| Polyclonal | |
| Purified | |
| RUO | |
| EC 1.1.1.170, H105e3, member 1, NAD(P) dependent steroid dehydrogenase-like, SDR31E1, sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating, XAP104 | |
| NSDHL | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q15738 | |
| 50814 | |
| Synthetic peptides corresponding to NSDHL(NAD(P) dependent steroid dehydrogenase-like) The peptide sequence was selected from the middle region of NSDHL. Peptide sequence RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title