NSDHL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59799

Product Code. 18283953

Description

NSDHL Polyclonal specifically detects NSDHL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NSDHL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.1.1.170, H105e3, member 1, NAD(P) dependent steroid dehydrogenase-like, SDR31E1, sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating, XAP104
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15738
• Gene Symbols: NSDHL
• Immunogen: Synthetic peptides corresponding to NSDHL(NAD(P) dependent steroid dehydrogenase-like) The peptide sequence was selected from the middle region of NSDHL. Peptide sequence RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 50814
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG