missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NRN1L Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £366.00
Specifications
| Antigen | NRN1L |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18683790
|
Novus Biologicals
NBP2-94688-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653570
|
Novus Biologicals
NBP2-94688-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NRN1L Polyclonal antibody specifically detects NRN1L in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| NRN1L | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 123904 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| MGC118990, MGC118993, MRCC2446, neuritin 1-like, neuritin-like protein, UNQ2446 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 39-139 of human NRN1L (Q496H8). PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title