missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOP10 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£177.00 - £366.00
Specifications
| Antigen | NOP10 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18696150
|
Novus Biologicals
NBP2-93614-0.02ml |
0.02 mL |
£177.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678240
|
Novus Biologicals
NBP2-93614-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NOP10 Polyclonal antibody specifically detects NOP10 in Human, Mouse samples. It is validated for Western BlotSpecifications
| NOP10 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 55505 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| H/ACA ribonucleoprotein complex subunit 3, homolog of yeast Nop10p, MGC70651, NOLA3Nucleolar protein family A member 3, NOP10 ribonucleoprotein homolog (yeast), NOP10P, Nucleolar protein 10, nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs), snoRNP protein NOP10 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human NOP10 (NP_061118.1). MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title