NOP10 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93614-0.1ml

Product Code. 18678240

Description

NOP10 Polyclonal antibody specifically detects NOP10 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: NOP10
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: H/ACA ribonucleoprotein complex subunit 3, homolog of yeast Nop10p, MGC70651, NOLA3Nucleolar protein family A member 3, NOP10 ribonucleoprotein homolog (yeast), NOP10P, Nucleolar protein 10, nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs), snoRNP protein NOP10
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human NOP10 (NP_061118.1). MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 55505
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified