missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NOB1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NOB1 Polyclonal specifically detects NOB1 in Human samples. It is validated for Western Blot.Specifications
| NOB1 | |
| Polyclonal | |
| Rabbit | |
| Q9ULX3 | |
| 28987 | |
| Synthetic peptides corresponding to NOB1(NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOB1. Peptide sequence TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| adenocarcinoma antigen recognized by T lymphocytes 4, ART4, ART-4, MST158, nin one binding protein, NIN1/RPN12 binding protein 1 homolog (S. cerevisiae), NOB1PPSMD8BP1, Phosphorylation regulatory protein HP-10, Protein ART-4, PSMD8 binding protein 1, RNA-binding protein NOB1 | |
| NOB1 | |
| IgG | |
| 47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title