missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £366.00
Specifications
| Antigen | Nicotinic Acetylcholine R alpha 6/CHRNA6 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18651101
|
Novus Biologicals
NBP2-94679-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18655621
|
Novus Biologicals
NBP2-94679-0.1ml |
0.1 mL |
£366.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
Nicotinic Acetylcholine R alpha 6/CHRNA6 Polyclonal antibody specifically detects Nicotinic Acetylcholine R alpha 6/CHRNA6 in Human, Mouse samples. It is validated for Western BlotTekniske data
| Nicotinic Acetylcholine R alpha 6/CHRNA6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Neurodegeneration, Neuroscience | |
| PBS (pH 7.3), 50% glycerol | |
| 8973 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| CHNRA6, cholinergic receptor, nicotinic, alpha 6, cholinergic receptor, nicotinic, alpha polypeptide 6, neuronal acetylcholine receptor subunit alpha-6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 350-440 of human CHRNA6 (NP_004189.1). PQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel