missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94679-0.02ml
This item is not returnable.
View return policy
Description
Nicotinic Acetylcholine R alpha 6/CHRNA6 Polyclonal antibody specifically detects Nicotinic Acetylcholine R alpha 6/CHRNA6 in Human, Mouse samples. It is validated for Western Blot
Specifications
| Nicotinic Acetylcholine R alpha 6/CHRNA6 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CHNRA6, cholinergic receptor, nicotinic, alpha 6, cholinergic receptor, nicotinic, alpha polypeptide 6, neuronal acetylcholine receptor subunit alpha-6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 350-440 of human CHRNA6 (NP_004189.1). PQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIA | |
| 0.02 mL | |
| Alzheimers Research, Neurodegeneration, Neuroscience | |
| 8973 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction