missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NHERF-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91569
This item is not returnable.
View return policy
Description
NHERF-2 Polyclonal specifically detects NHERF-2 in Rat samples. It is validated for Western Blot.
Specifications
| NHERF-2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| E3KARP, Na(+)/H(+) exchange regulatory cofactor NHE-RF2, NHE3RF2, NHERF2MGC104639, NHERF-2NHE3 kinase A regulatory protein E3KARP, OCTS2, SIP-1SRY-interacting protein 1, sodium/hydrogen exchanger, Sodium-hydrogen exchanger regulatory factor 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatoryfactor 2, solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2, Solute carrier family 9 isoform A3 regulatory factor 2, TKA-1SIP1, Tyrosine kinase activator protein 1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9351 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_446263 | |
| SLC9A3R2 | |
| Synthetic peptide directed towards the N terminal of human Slc9a3r2. Peptide sequence RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Pig: 92%; Xenopus: 90%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction