missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NGX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | NGX6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
NGX6 Polyclonal specifically detects NGX6 in Human samples. It is validated for Western Blot.Specifications
| NGX6 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q5TCW5 | |
| 51754 | |
| Synthetic peptides corresponding to NGX6 The peptide sequence was selected from the C terminal of NGX6. Peptide sequence FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| C9orf127, chromosome 9 open reading frame 127, NAG-5, nasopharyngeal carcinoma expressed 6, nasopharyngeal carcinoma related protein, Nasopharyngeal carcinoma-associated gene 6 protein, NGX6MGC120460, Protein NAG-5, Protein NGX6, RP11-112J3.10, transmembrane protein 8B | |
| TMEM8B | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title