missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NGX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-60059
This item is not returnable.
View return policy
Description
NGX6 Polyclonal specifically detects NGX6 in Human samples. It is validated for Western Blot.
Specifications
| NGX6 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C9orf127, chromosome 9 open reading frame 127, NAG-5, nasopharyngeal carcinoma expressed 6, nasopharyngeal carcinoma related protein, Nasopharyngeal carcinoma-associated gene 6 protein, NGX6MGC120460, Protein NAG-5, Protein NGX6, RP11-112J3.10, transmembrane protein 8B | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Bovine: 100%; Mouse: 100%; Rat: 100%;. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q5TCW5 | |
| TMEM8B | |
| Synthetic peptides corresponding to NGX6 The peptide sequence was selected from the C terminal of NGX6. Peptide sequence FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS. | |
| 100 μL | |
| Cell Cycle and Replication | |
| 51754 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction