missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFkB2/NFkB p100 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£258.00 - £444.00
Specifications
| Antigen | NFkB2/NFkB p100 |
|---|---|
| Concentration | 0.2mg/mL |
| Dilution | Western Blot 0.04-0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18431292
|
Novus Biologicals
NBP1-87760-25ul |
25 μL |
£258.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18737263
|
Novus Biologicals
NBP1-87760 |
£444.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
NFkB2/NFkB p100 Polyclonal antibody specifically detects NFkB2/NFkB p100 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Knockdown.Specifications
| NFkB2/NFkB p100 | |
| Western Blot 0.04-0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4791 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.2mg/mL | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, LYT10LYT-10, nuclear factor NF-kappa-B p100 subunit, nuclear factor of kappa light chain gene enhancer in B-cells 2, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Oncogene Lyt-10, p52 | |
| NFKB2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human NFkB2/NFkB p100 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title