missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NFkB2/NFkB p100 Antibody, Novus Biologicals™

NFkB2/NFkB p100 Antibody, Novus Biologicals™

Product Code. 18431292 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18431292 25 μL 25µL
18737263 - 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18431292 Supplier Novus Biologicals Supplier No. NBP18776025ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NFkB2/NFkB p100 Polyclonal antibody specifically detects NFkB2/NFkB p100 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Knockdown.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NFkB2/NFkB p100
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, LYT10LYT-10, nuclear factor NF-kappa-B p100 subunit, nuclear factor of kappa light chain gene enhancer in B-cells 2, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Oncogene Lyt-10, p52
Gene Symbols NFKB2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 4791
Test Specificity Specificity of human NFkB2/NFkB p100 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.