missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93230-0.02ml
This item is not returnable.
View return policy
Description
Neuromedin UR2/NMUR2 Polyclonal antibody specifically detects Neuromedin UR2/NMUR2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Neuromedin UR2/NMUR2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FM4, G-protein coupled receptor FM-4, G-protein coupled receptor TGR-1, growth hormone secretagogue receptor family, member 4, neuromedin U receptor 2, neuromedin-U receptor 2, NMU2RFM-4, NMU-R2, TGR1, TGR-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3). IYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT | |
| 0.02 mL | |
| GPCR | |
| 56923 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction