missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93230-0.02ml
This item is not returnable.
View return policy
Description
Neuromedin UR2/NMUR2 Polyclonal antibody specifically detects Neuromedin UR2/NMUR2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Neuromedin UR2/NMUR2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FM4, G-protein coupled receptor FM-4, G-protein coupled receptor TGR-1, growth hormone secretagogue receptor family, member 4, neuromedin U receptor 2, neuromedin-U receptor 2, NMU2RFM-4, NMU-R2, TGR1, TGR-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3). IYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT | |
| 0.02 mL | |
| GPCR | |
| 56923 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion