missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £375.00
Specifications
| Antigen | Neuromedin UR2/NMUR2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18655001
|
Novus Biologicals
NBP2-93230-0.02ml |
0.02 mL | |||||||
|
18673580
|
Novus Biologicals
NBP2-93230-0.1ml |
0.1 mL |
£375.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Neuromedin UR2/NMUR2 Polyclonal antibody specifically detects Neuromedin UR2/NMUR2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Neuromedin UR2/NMUR2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.3), 50% glycerol | |
| 56923 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FM4, G-protein coupled receptor FM-4, G-protein coupled receptor TGR-1, growth hormone secretagogue receptor family, member 4, neuromedin U receptor 2, neuromedin-U receptor 2, NMU2RFM-4, NMU-R2, TGR1, TGR-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3). IYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title