missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuromedin UR1/NMUR1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £366.00
Specifications
| Antigen | Neuromedin UR1/NMUR1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18677612
|
Novus Biologicals
NBP2-94246-0.02ml |
0.02 mL |
£164.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18649321
|
Novus Biologicals
NBP2-94246-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Neuromedin UR1/NMUR1 Polyclonal antibody specifically detects Neuromedin UR1/NMUR1 in Human, Mouse samples. It is validated for Western BlotSpecifications
| Neuromedin UR1/NMUR1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.3), 50% glycerol | |
| 10316 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| (FM-3), FM3, FM-3, G protein-coupled receptor 66, GPC-R, GPR66G-protein coupled receptor 66, G-protein coupled receptor FM-3, neuromedin U receptor 1, neuromedin-U receptor 1, NMU1R, NMU-R1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 360-426 of human NMUR1 (NP_006047.3). SSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title