missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuromedin UR1/NMUR1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94246-0.1ml
This item is not returnable.
View return policy
Description
Neuromedin UR1/NMUR1 Polyclonal antibody specifically detects Neuromedin UR1/NMUR1 in Human, Mouse samples. It is validated for Western Blot
Specifications
| Neuromedin UR1/NMUR1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| (FM-3), FM3, FM-3, G protein-coupled receptor 66, GPC-R, GPR66G-protein coupled receptor 66, G-protein coupled receptor FM-3, neuromedin U receptor 1, neuromedin-U receptor 1, NMU1R, NMU-R1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 360-426 of human NMUR1 (NP_006047.3). SSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS | |
| 0.1 mL | |
| GPCR | |
| 10316 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction