Neuromedin UR1/NMUR1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94246-0.1ml

Artikelnummer. 18649321

Beschreibung

Neuromedin UR1/NMUR1 Polyclonal antibody specifically detects Neuromedin UR1/NMUR1 in Human, Mouse samples. It is validated for Western Blot

Spezifikation

• Antigen: Neuromedin UR1/NMUR1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: (FM-3), FM3, FM-3, G protein-coupled receptor 66, GPC-R, GPR66G-protein coupled receptor 66, G-protein coupled receptor FM-3, neuromedin U receptor 1, neuromedin-U receptor 1, NMU1R, NMU-R1
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-426 of human NMUR1 (NP_006047.3). SSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS
• Quantity: 0.1 mL
• Research Discipline: GPCR
• Gene ID (Entrez): 10316
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified