missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuro D4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Neuro D4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Neuro D4 Polyclonal specifically detects Neuro D4 in Human, Rat samples. It is validated for Western Blot.Specifications
| Neuro D4 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| BAF45B, BRG1-associated factor 45B, D4, zinc and double PHD fingers family 1NEUD4BAF45b, MGC150428, MGC150429, neuro-d4, neuro-d4 homolog, zinc finger protein neuro-d4 | |
| DPF1 | |
| IgG | |
| 40 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_004638 | |
| 8193 | |
| Synthetic peptide directed towards the middle region of human DPF1. Peptide sequence KELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCAD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title