Neuro D4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80040

Product Code. 18260486

Description

Neuro D4 Polyclonal specifically detects Neuro D4 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Neuro D4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BAF45B, BRG1-associated factor 45B, D4, zinc and double PHD fingers family 1NEUD4BAF45b, MGC150428, MGC150429, neuro-d4, neuro-d4 homolog, zinc finger protein neuro-d4
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 8193
• Target Species: Human, Rat, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_004638
• Gene Symbols: DPF1
• Immunogen: Synthetic peptide directed towards the middle region of human DPF1. Peptide sequence KELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCAD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.