missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NETO2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NETO2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NETO2 Polyclonal specifically detects NETO2 in Human samples. It is validated for Western Blot.Specifications
| NETO2 | |
| Polyclonal | |
| Rabbit | |
| Q8NC67 | |
| 81831 | |
| Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2 (NP_060562). GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 2, BTCL2, FLJ10430, FLJ90456, NEOT2FLJ14724, neuropilin (NRP) and tolloid (TLL)-like 2, neuropilin and tolloid-like protein 2 | |
| NETO2 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title