NETO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-62427

Product Code. 18281884

Description

NETO2 Polyclonal specifically detects NETO2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NETO2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 2, BTCL2, FLJ10430, FLJ90456, NEOT2FLJ14724, neuropilin (NRP) and tolloid (TLL)-like 2, neuropilin and tolloid-like protein 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NC67
• Gene Symbols: NETO2
• Immunogen: Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2 (NP_060562). GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81831
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG