missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NELF-E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55487
This item is not returnable.
View return policy
Description
NELF-E Polyclonal specifically detects NELF-E in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| NELF-E | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| D6S45, negative elongation factor E, negative elongation factor polypeptide E, NELFE, NELF-ERDmajor histocompatibility complex gene RD, nuclear protein, RD RNA binding protein, RD RNA-binding protein, RDP, RNA-binding protein RD | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RDBP | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVYKE | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 7936 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction