missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NELF-E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NELF-E |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NELF-E Polyclonal specifically detects NELF-E in Human samples. It is validated for Western Blot.Specifications
| NELF-E | |
| Polyclonal | |
| Rabbit | |
| P18615 | |
| 7936 | |
| Synthetic peptides corresponding to RDBP(RD RNA binding protein) The peptide sequence was selected from the N terminal of RDBP. Peptide sequence QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| D6S45, negative elongation factor E, negative elongation factor polypeptide E, NELFE, NELF-ERDmajor histocompatibility complex gene RD, nuclear protein, RD RNA binding protein, RD RNA-binding protein, RDP, RNA-binding protein RD | |
| RDBP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title