NEK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57424-25ul

Product Code. 18667938

Description

NEK2 Polyclonal specifically detects NEK2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NEK2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 2.7.11, EC 2.7.11.1, HSPK 21, NEK2AHsPK21, Never in mitosis A-related kinase 2, NIMA (never in mitosis gene a)-related kinase 2, NimA-like protein kinase 1, NimA-related protein kinase 2, NLK1serine/threonine-protein kinase Nek2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NEK2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers
• Gene ID (Entrez): 4751
• Target Species: Human
• Form: Purified

For Research Use Only