NECAP2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93292-0.1ml

Product Code. 18657050

Description

NECAP2 Polyclonal antibody specifically detects NECAP2 in Mouse samples. It is validated for Western Blot

Specifications

• Antigen: NECAP2
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: adaptin ear-binding coat-associated protein 2, adaptin-ear-binding coat-associated protein 2, FLJ10420, NECAP endocytosis associated 2, NECAP endocytosis-associated protein 2, NECAP-2
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 194-263 of human NECAP2 (NP_060560.1). GKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55707
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified