missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFV1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£285.00 - £423.00
Specifications
| Antigen | NDUFV1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NDUFV1 Polyclonal specifically detects NDUFV1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NDUFV1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 4723 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| CI-51K, CI-51kD, CI51KD, complex I 51kDa subunit, complex I, mitochondrial respiratory chain, Complex I-51kD, EC 1.6.5.3, EC 1.6.99.3, EC 1.6.99.5, FLJ59059, mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1, NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD), NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, NADH dehydrogenase flavoprotein 1, NADH-ubiquinone oxidoreductase 51 kDa subunit, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial | |
| NDUFV1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title