NDUFV1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57926-25ul

Product Code. 18669917

Description

NDUFV1 Polyclonal specifically detects NDUFV1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NDUFV1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CI-51K, CI-51kD, CI51KD, complex I 51kDa subunit, complex I, mitochondrial respiratory chain, Complex I-51kD, EC 1.6.5.3, EC 1.6.99.3, EC 1.6.99.5, FLJ59059, mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1, NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD), NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, NADH dehydrogenase flavoprotein 1, NADH-ubiquinone oxidoreductase 51 kDa subunit, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4723
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NDUFV1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only