missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFS8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NDUFS8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NDUFS8 Polyclonal specifically detects NDUFS8 in Human samples. It is validated for Western Blot.Specifications
| NDUFS8 | |
| Polyclonal | |
| Rabbit | |
| NP_002487 | |
| 4728 | |
| The immunogen for this antibody is NDUFS8. Peptide sequence: CKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVD | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CI-23k, CI-23kD, CI23KD, complex I 23kDa subunit, Complex I-23kD, EC 1.6.5.3, EC 1.6.99.3, EC 1.6.99.5, NADH dehydrogenase (ubiquinone) Fe-S protein 8 (23kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial, NADH-ubiquinone oxidoreductase 23 kDa subunit, TYKY, TYKY subunit | |
| NDUFS8 | |
| IgG | |
| 23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title