missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFS8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79907
This item is not returnable.
View return policy
Description
NDUFS8 Polyclonal specifically detects NDUFS8 in Human samples. It is validated for Western Blot.
Specifications
| NDUFS8 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CI-23k, CI-23kD, CI23KD, complex I 23kDa subunit, Complex I-23kD, EC 1.6.5.3, EC 1.6.99.3, EC 1.6.99.5, NADH dehydrogenase (ubiquinone) Fe-S protein 8 (23kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial, NADH-ubiquinone oxidoreductase 23 kDa subunit, TYKY, TYKY subunit | |
| Rabbit | |
| 23 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Xenopus: 100%; Chicken: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_002487 | |
| NDUFS8 | |
| The immunogen for this antibody is NDUFS8. Peptide sequence: CKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVD | |
| Affinity purified | |
| RUO | |
| 4728 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction