missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | NDUFC2 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625285
|
Novus Biologicals
NBP2-46831-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18680986
|
Novus Biologicals
NBP2-46831 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NDUFC2 Polyclonal antibody specifically detects NDUFC2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NDUFC2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| B14.5b, CI-B14.5b, complex I subunit B14.5b, Complex I-B14.5b, HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b), Human lung cancer oncogene 1 protein, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 subunit C2, NADHDH2, NADH-ubiquinone oxidoreductase subunit B14.5b | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| O95298 | |
| 4718 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title