NDUFC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-46831-25ul

Product Code. 18625285

Description

NDUFC2 Polyclonal antibody specifically detects NDUFC2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NDUFC2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: O95298
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: B14.5b, CI-B14.5b, complex I subunit B14.5b, Complex I-B14.5b, HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b), Human lung cancer oncogene 1 protein, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 subunit C2, NADHDH2, NADH-ubiquinone oxidoreductase subunit B14.5b
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDK
• Quantity: 25 μL
• Research Discipline: Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 4718
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG