missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFB5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£154.00 - £434.00
Specifications
| Antigen | NDUFB5 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231478
|
Novus Biologicals
NBP3-37941-100ul |
100 μL |
£434.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230098
|
Novus Biologicals
NBP3-37941-20ul |
20 μL |
£154.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NDUFB5 Polyclonal antibody specifically detects NDUFB5 in Human samples. It is validated for ELISA,Western BlotSpecifications
| NDUFB5 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 4711 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 5 (16kD, SGDH), CISGDH, CI-SGDH, Complex I-SGDH, DKFZp686N02262, FLJ30597, MGC111204, MGC12314, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, SGDH | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1).,, Sequence:, EIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title