missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFB5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37941-100ul
This item is not returnable.
View return policy
Description
NDUFB5 Polyclonal antibody specifically detects NDUFB5 in Human samples. It is validated for ELISA,Western Blot
Specifications
| NDUFB5 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| 5 (16kD, SGDH), CISGDH, CI-SGDH, Complex I-SGDH, DKFZp686N02262, FLJ30597, MGC111204, MGC12314, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, SGDH | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1).,, Sequence:, EIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN | |
| 100 μL | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 4711 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction