missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFA9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NDUFA9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NDUFA9 Polyclonal specifically detects NDUFA9 in Human samples. It is validated for Western Blot.Specifications
| NDUFA9 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| CC6, CI39k, CI-39k, CI-39kD, complex I 39kDa subunit, Complex I-39kD, MGC111043, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase), NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L, SDR22E1, short chain dehydrogenase/reductase family 22E, member 1 | |
| NDUFA9 | |
| IgG | |
| This product is specific to Subunit or Isoform: 9, mitochondrial. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q16795 | |
| 4704 | |
| Synthetic peptides corresponding to NDUFA9(NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa) The peptide sequence was selected from the N terminal of NDUFA9. Peptide sequence QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY. | |
| Primary | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title