missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDNL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NDNL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NDNL2 Polyclonal specifically detects NDNL2 in Human samples. It is validated for Western Blot.Specifications
| NDNL2 | |
| Polyclonal | |
| Rabbit | |
| NP_619649 | |
| 56160 | |
| Synthetic peptide directed towards the middle region of human NDNL2The immunogen for this antibody is NDNL2. Peptide sequence IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HCA4hepatocellular carcinoma-associated protein HCA4, Hepatocellular carcinoma-associated protein 4, MAGEG1MAGE-G1 antigen, MAGEL3, melanoma antigen, family G, 1, melanoma-associated antigen G1, necdin-like 2, necdin-like gene 2, Necdin-like protein 2, NSE3, NSMCE3 | |
| NDNL2 | |
| IgG | |
| 34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title