NDNL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79687

Product Code. 18228775

Description

NDNL2 Polyclonal specifically detects NDNL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NDNL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HCA4hepatocellular carcinoma-associated protein HCA4, Hepatocellular carcinoma-associated protein 4, MAGEG1MAGE-G1 antigen, MAGEL3, melanoma antigen, family G, 1, melanoma-associated antigen G1, necdin-like 2, necdin-like gene 2, Necdin-like protein 2, NSE3, NSMCE3
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_619649
• Gene Symbols: NDNL2
• Immunogen: Synthetic peptide directed towards the middle region of human NDNL2The immunogen for this antibody is NDNL2. Peptide sequence IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56160
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG