missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDC80 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | NDC80 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18208461
|
Novus Biologicals
NBP2-56920 |
100 μL |
£460.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18619388
|
Novus Biologicals
NBP2-56920-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NDC80 Polyclonal specifically detects NDC80 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| NDC80 | |
| Polyclonal | |
| Rabbit | |
| Cell Biology, Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Mitotic Regulators, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10403 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| HEC1KNTC2, HECRetinoblastoma-associated protein HEC, Highly expressed in cancer protein, highly expressed in cancer, rich in leucine heptad repeats, highly expressed in cancer, rich in leucine heptad repeats (yeast), hsHec1, hsNDC80, kinetochore associated 2, Kinetochore protein Hec1, kinetochore protein NDC80 homolog, Kinetochore-associated protein 2, NDC80 homolog, kinetochore complex component (S. cerevisiae), TID3 | |
| NDC80 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title